PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA000952-PA
Common NameOsI_03417
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 302aa    MW: 33356.1 Da    PI: 6.344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA000952-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151765148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                      +g W++eEde+l++ + ++G g+W+++++  g + R++k+c++rw +yl
  BGIOSGA000952-PA 17 KGLWSPEEDEKLYNHIYRYGVGCWSSVPKLAGrLQRCGKSCRLRWINYL 65
                      678********************************************97 PP

2Myb_DNA-binding483e-1571115147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  BGIOSGA000952-PA  71 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 115
                       899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-221268IPR009057Homeodomain-like
PROSITE profilePS5129415.7711265IPR017930Myb domain
SuperFamilySSF466891.09E-2715112IPR009057Homeodomain-like
SMARTSM007176.6E-121667IPR001005SANT/Myb domain
PfamPF002493.1E-141765IPR001005SANT/Myb domain
CDDcd001673.03E-112065No hitNo description
PROSITE profilePS5129424.51766120IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2569120IPR009057Homeodomain-like
SMARTSM007172.2E-1470118IPR001005SANT/Myb domain
PfamPF002491.4E-1371115IPR001005SANT/Myb domain
CDDcd001672.54E-1073113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRHACSAAG VQQKLRKGLW SPEEDEKLYN HIYRYGVGCW SSVPKLAGRL QRCGKSCRLR  60
WINYLRPDLK RGSFSQQEED AIVGLHEILG NRWSQIASHL PGRTDNEIKN FWNSCLKKKL  120
RQRGIDPSTH QPISTAAAAA AAALDTSTQD QKPPATADGF ALKQQQQVFD PFPVIDSFGS  180
GFDATGMPLY GHLGGKDAAG FVDYSSVLDV SENLGYGESS SNSSNWNCGV GAPEVNNALE  240
SEPLHWATES KVEPFVGYGE GDAMEHKFGL PCHGQQEQGM THFDFDVSRS MVVGDFNFEY  300
FR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29151205108B-MYB
1h8a_C1e-281512025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115121LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.458920.0flower| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884450.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117820.0AK111782.1 Oryza sativa Japonica Group cDNA clone:J023084H22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633604.10.0PREDICTED: myb-related protein Hv33
SwissprotP200271e-104MYB3_HORVU; Myb-related protein Hv33
TrEMBLA2WU700.0A2WU70_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA000952-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-74myb domain protein 86